PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100152920151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 396aa    MW: 45092 Da    PI: 9.7547
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100152920151genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-3186139255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtp+LH +Fv+a+e+LGG+e+AtPk++l+lm+v gL+++hvkSHLQ+YR+
  Ote100152920151|100152920151  86 PRLRWTPDLHLSFVHAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQMYRS 139
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-2982140IPR009057Homeodomain-like
PROSITE profilePS5129410.40982142IPR017930Myb domain
SuperFamilySSF466891.77E-1484140IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2386141IPR006447Myb domain, plants
PfamPF002492.5E-887138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MEDIVSGEEI INGGQADNTV TSSSDRSSID LNEDAGSNEV GDPMNEVSSI SIQRRDEKSG  60
ESSKQSDEEK EKNKNAVRQY VRSKMPRLRW TPDLHLSFVH AIERLGGQER ATPKAVLQLM  120
NVRGLSISHV KSHLQMYRSK KLDESGRVIG GSNRVYIQGR GYVYDKCSSP FHELRIENGG  180
IVFARNSNLQ QDCSIPFPQT LKYHQPYFKN LSSRYHPWFS SYRHEPKVRL DSQLMSDAGK  240
DRFSGGPSRP AQFLEGRRWP PIHSQFKEKD VSKSNSIWSS TLSQNNFKPL INLEKPSRLQ  300
MNEERKFNRK DWFPVNLKLN LSLGLNDIND QKACSNDGDR SGINTKLSLA LAPHSSSTAT  360
XXXXXXXXXX XXXXPLSLFF GRLIYSHTFL NRSEFD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.11e-120PREDICTED: two-component response regulator ARR1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334